Lineage for d1vdda_ (1vdd A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1695175Fold e.49: Recombination protein RecR [111303] (1 superfamily)
    consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)
  4. 1695176Superfamily e.49.1: Recombination protein RecR [111304] (1 family) (S)
  5. 1695177Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
    three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively
  6. 1695178Protein Recombination protein RecR [111306] (2 species)
  7. 1695179Species Deinococcus radiodurans [TaxId:1299] [111307] (2 PDB entries)
    Uniprot Q9ZNA2
  8. 1695180Domain d1vdda_: 1vdd A: [108519]
    complexed with imd, zn

Details for d1vdda_

PDB Entry: 1vdd (more details), 2.5 Å

PDB Description: crystal structure of recombinational repair protein recr
PDB Compounds: (A:) recombination protein recr

SCOPe Domain Sequences for d1vdda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]}
mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
tdevtlgraltgrqtvskp

SCOPe Domain Coordinates for d1vdda_:

Click to download the PDB-style file with coordinates for d1vdda_.
(The format of our PDB-style files is described here.)

Timeline for d1vdda_: