Lineage for d1vd5a_ (1vd5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335134Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2335350Family a.102.1.7: Glycosyl Hydrolase Family 88 [109953] (2 proteins)
    Pfam PF07470
  6. 2335351Protein Unsaturated glucuronyl hydrolase [109954] (1 species)
  7. 2335352Species Bacillus sp. GL1 [TaxId:84635] [109955] (4 PDB entries)
    Uniprot Q9RC92
  8. 2335356Domain d1vd5a_: 1vd5 A: [108518]
    complexed with dtt, gly, mpd

Details for d1vd5a_

PDB Entry: 1vd5 (more details), 1.8 Å

PDB Description: Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d1vd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vd5a_ a.102.1.7 (A:) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}
mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
llrlergvtgywyergr

SCOPe Domain Coordinates for d1vd5a_:

Click to download the PDB-style file with coordinates for d1vd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1vd5a_: