Lineage for d1vcta2 (1vct A:108-201)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like foldSuperfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) 
Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
Pfam PF02080
Protein Hypothetical protein PH0236, C-terminal domain [143625] (1 species) Species Pyrococcus horikoshii [TaxId:53953] [143626] (4 PDB entries)
Uniprot O57975 108-201
Domain d1vcta2: 1vct A:108-201 [119987]
Other proteins in same PDB: d1vcta1
complexed with cl, edo, na
Details for d1vcta2
PDB Entry: 1vct (more details), 1.85 Å
PDB Description: Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein ph0236SCOPe Domain Sequences for d1vcta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcta2 d.286.1.1 (A:108-201) Hypothetical protein PH0236, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
lhpviketilegeeiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpne
nfkiragdvligrgtrtsidhlkeiargairvig
SCOPe Domain Coordinates for d1vcta2:
Click to download the PDB-style file with coordinates for d1vcta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vcta2:
- d1vcta2 first appeared in SCOP 1.73
- d1vcta2 appears in SCOPe 2.07
View in 3D
