Lineage for d1vcta1 (1vct A:9-107)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.7.12: PhoU-like [109755] (2 families) 
duplication: consists of two sequence each repeats adopting this foldFamily a.7.12.1: PhoU-like [109756] (3 proteins)
Pfam PF01895
this is a repeat family; one repeat unit is 1vct A:9-107 found in domainProtein Hypothetical protein PH0236, N-terminal domain [140350] (1 species)
form dimers of dimers, similar to PhoU subunits and dimers, respectivelySpecies Pyrococcus horikoshii [TaxId:53953] [140351] (4 PDB entries)
Uniprot O57975 9-107
Domain d1vcta1: 1vct A:9-107 [119986]
Other proteins in same PDB: d1vcta2
complexed with cl, edo, na
applies to all domains of a family if the common domain is composed of a different number of small repeating units
Details for d1vcta1
PDB Entry: 1vct (more details), 1.85 Å
PDB Description: Crystal structure of putative potassium channel related protein from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein ph0236SCOPe Domain Sequences for d1vcta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcta1 a.7.12.1 (A:9-107) Hypothetical protein PH0236, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
arnvkeaeqvitilqianaiedisnaagdlakmvlegve
SCOPe Domain Coordinates for d1vcta1:
Click to download the PDB-style file with coordinates for d1vcta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vcta1:
- d1vcta1 first appeared in SCOP 1.73
- d1vcta1 appears in SCOPe 2.07
View in 3D
