Lineage for d1vchb_ (1vch B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891731Protein automated matches [190074] (15 species)
    not a true protein
  7. 2891793Species Thermus thermophilus [TaxId:274] [188051] (1 PDB entry)
  8. 2891794Domain d1vchb_: 1vch B: [119981]
    Other proteins in same PDB: d1vcha1
    automated match to d1vcha1
    complexed with acy, ca, cl

Details for d1vchb_

PDB Entry: 1vch (more details), 1.94 Å

PDB Description: Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
PDB Compounds: (B:) Phosphoribosyltransferase-related protein

SCOPe Domain Sequences for d1vchb_:

Sequence, based on SEQRES records: (download)

>d1vchb_ c.61.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
tspiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaeklln
qrvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

Sequence, based on observed residues (ATOM records): (download)

>d1vchb_ c.61.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
metypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilftte
tspiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvl
vsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

SCOPe Domain Coordinates for d1vchb_:

Click to download the PDB-style file with coordinates for d1vchb_.
(The format of our PDB-style files is described here.)

Timeline for d1vchb_: