Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Putative phosphoribosyltransferase TTHA1613 [142558] (1 species) putative APRTase in UniProt |
Species Thermus thermophilus [TaxId:274] [142559] (1 PDB entry) Uniprot Q5SHW7 2-175 |
Domain d1vcha1: 1vch A:2-175 [119980] Other proteins in same PDB: d1vchb_, d1vchc_, d1vchd_, d1vche_ complexed with acy, ca, cl |
PDB Entry: 1vch (more details), 1.94 Å
SCOPe Domain Sequences for d1vcha1:
Sequence, based on SEQRES records: (download)
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet spiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaekllnq rvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet spiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvlv sdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl
Timeline for d1vcha1:
View in 3D Domains from other chains: (mouse over for more information) d1vchb_, d1vchc_, d1vchd_, d1vche_ |