Lineage for d1vcha1 (1vch A:2-175)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499417Protein Putative phosphoribosyltransferase TTHA1613 [142558] (1 species)
    putative APRTase in UniProt
  7. 2499418Species Thermus thermophilus [TaxId:274] [142559] (1 PDB entry)
    Uniprot Q5SHW7 2-175
  8. 2499419Domain d1vcha1: 1vch A:2-175 [119980]
    Other proteins in same PDB: d1vchb_, d1vchc_, d1vchd_, d1vche_
    complexed with acy, ca, cl

Details for d1vcha1

PDB Entry: 1vch (more details), 1.94 Å

PDB Description: Crystal Structure of a Phosphoribosyltransferase-related protein from Thermus thermophilus
PDB Compounds: (A:) Phosphoribosyltransferase-related protein

SCOPe Domain Sequences for d1vcha1:

Sequence, based on SEQRES records: (download)

>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]}
etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet
spiplthvlaealglpyvvarrrrrpymedpiiqevqtltlgvgevlwldrrfaekllnq
rvvlvsdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

Sequence, based on observed residues (ATOM records): (download)

>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]}
etypitvggvtrhvplieplpgrriplveflgdpeftraaaealrplvpkeaeilfttet
spiplthvlaealglpyvvarrrrrpymedpiiqevqtgevlwldrrfaekllnqrvvlv
sdvvasgetmramekmvlragghvvarlavfrqgtpglavdtvaelpvl

SCOPe Domain Coordinates for d1vcha1:

Click to download the PDB-style file with coordinates for d1vcha1.
(The format of our PDB-style files is described here.)

Timeline for d1vcha1: