Lineage for d1vc9a1 (1vc9 A:1-126)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.1: MutT-like [55812] (17 proteins) 
Protein AP6A hydrolase Ndx1 [143758] (1 species) Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
Uniprot Q75UV1 1-126
Domain d1vc9a1: 1vc9 A:1-126 [119968]
complexed with atp, mg; mutant
Details for d1vc9a1
PDB Entry: 1vc9 (more details), 2.3 Å
PDB Description: crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant- mg2+-atp complex
PDB Compounds: (A:) Ndx1SCOPe Domain Sequences for d1vc9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc9a1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweqtgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl
SCOPe Domain Coordinates for d1vc9a1:
Click to download the PDB-style file with coordinates for d1vc9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vc9a1:
- d1vc9a1 first appeared in SCOP 1.73
- d1vc9a1 appears in SCOPe 2.07
View in 3D
