Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein AP6A hydrolase Ndx1 [143758] (1 species) |
Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries) Uniprot Q75UV1 1-126 |
Domain d1vc8a1: 1vc8 A:1-126 [119966] complexed with 5fa |
PDB Entry: 1vc8 (more details), 2 Å
SCOPe Domain Sequences for d1vc8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc8a1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva lerlpl
Timeline for d1vc8a1: