Lineage for d1vc8a1 (1vc8 A:1-126)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. Protein AP6A hydrolase Ndx1 [143758] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [143759] (3 PDB entries)
    Uniprot Q75UV1 1-126
  8. Domain d1vc8a1: 1vc8 A:1-126 [119966]
    complexed with 5fa

Details for d1vc8a1

PDB Entry: 1vc8 (more details), 2 Å

PDB Description: Crystal Structure of a T.thermophilus HB8 Ap6A Hydrolase Ndx1-Ap6A Complex
PDB Compounds: (A:) Ndx1

SCOPe Domain Sequences for d1vc8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vc8a1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}
melgaggvvfnakrevlllrdrmgfwvfpkghpepgesleeaavrevweetgvraevllp
lyptryvnpkgverevhwflmrgegaprleegmtgagwfspeearallafpedlglleva
lerlpl

SCOPe Domain Coordinates for d1vc8a1 are not available.

Timeline for d1vc8a1:

Domains from other chains:
(mouse over for more information)
d1vc8b_