Lineage for d1vbga2 (1vbg A:383-517)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459236Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2459237Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2459238Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 2459239Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)
  7. 2459249Species Maize (Zea mays) [TaxId:4577] [141971] (2 PDB entries)
    Uniprot P11155 454-588
  8. 2459250Domain d1vbga2: 1vbg A:383-517 [119952]
    Other proteins in same PDB: d1vbga1, d1vbga3
    complexed with mg, so4

Details for d1vbga2

PDB Entry: 1vbg (more details), 2.3 Å

PDB Description: pyruvate phosphate dikinase from maize
PDB Compounds: (A:) pyruvate,orthophosphate dikinase

SCOPe Domain Sequences for d1vbga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbga2 c.8.1.1 (A:383-517) Pyruvate phosphate dikinase, central domain {Maize (Zea mays) [TaxId: 4577]}
qfenpsaykdqviatglpaspgaavgqvvftaedaeawhsqgkaailvraetspedvggm
haavgilterggmtshaavvargwgkccvsgcsgirvndaeklvtigghvlregewlsln
gstgevilgkqplsp

SCOPe Domain Coordinates for d1vbga2:

Click to download the PDB-style file with coordinates for d1vbga2.
(The format of our PDB-style files is described here.)

Timeline for d1vbga2: