Lineage for d1va0b_ (1va0 B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
consists of two non-similar domains
Domain 1 has parallel sheet of 5 strands, order 32415
Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the restSuperfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) 
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
Pfam PF00590
Protein automated matches [190790] (4 species)
not a true protein
Species Thermus thermophilus HB8 [TaxId:300852] [188045] (2 PDB entries) 
Domain d1va0b_: 1va0 B: [119900]
automated match to d1v9aa1
complexed with cl, edo
Details for d1va0b_
PDB Entry: 1va0 (more details), 1.97 Å
PDB Description: crystal structure of the native form of uroporphyrin iii c-methyl transferase from thermus thermophilus
PDB Compounds: (B:) Uroporphyrin-III C-methyltransferaseSCOPe Domain Sequences for d1va0b_:
Sequence, based on SEQRES records: (download)
>d1va0b_ c.90.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalal
Sequence, based on observed residues (ATOM records): (download)
>d1va0b_ c.90.1.1 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyveeihrlllr
harahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrglahg
faavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfverast
pkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalal
SCOPe Domain Coordinates for d1va0b_:
Click to download the PDB-style file with coordinates for d1va0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1va0b_:
- d1va0b_ first appeared in SCOP 1.73, called d1va0b1
- d1va0b_ appears in SCOPe 2.06
- d1va0b_ appears in the current release, SCOPe 2.08
View in 3D
