Lineage for d1v9ya_ (1v9y A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alphaSuperfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) 
alpha-beta(2)-alpha(2)-beta(3)
Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins) Protein Direct oxygen sensor protein, DOS [111118] (1 species)
Heme-regulated cyclic AMP phosphodiesterase; formerly hypothetical protein YddUSpecies Escherichia coli [TaxId:562] [111119] (5 PDB entries)
Uniprot P76129 8-126 ! Uniprot P76129 12-124
Domain d1v9ya_: 1v9y A: [108454]
complexed with hem
Details for d1v9ya_
PDB Entry: 1v9y (more details), 1.32 Å
PDB Description: Crystal Structure of the heme PAS sensor domain of Ec DOS (ferric form)
PDB Compounds: (A:) Heme pas sensor proteinSCOPe Domain Sequences for d1v9ya_:
Sequence, based on SEQRES records: (download)
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnreggkarvegmsrelqlekkdgskiwtrfalskvsaegkvyylalvrd
Sequence, based on observed residues (ATOM records): (download)
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]}
giffpaleqnmmgavlinendevmffnpaaeklwgykreevignnidmliprdlrpahpe
yirhnrerelqlekkdgskiwtrfalskvsaegkvyylalvrd
SCOPe Domain Coordinates for d1v9ya_:
Click to download the PDB-style file with coordinates for d1v9ya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v9ya_:
- d1v9ya_ first appeared in SCOP 1.69
- d1v9ya_ appears in SCOPe 2.04
- d1v9ya_ appears in SCOPe 2.06
- d1v9ya_ appears in the current release, SCOPe 2.08
View in 3D
