![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.19: SoxZ-like [141027] (1 protein) automatically mapped to Pfam PF08770 |
![]() | Protein Sulfur oxidation protein SoxZ [141028] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [141029] (1 PDB entry) Uniprot Q5SME6 2-107 TTHA1420 |
![]() | Domain d1v8ha1: 1v8h A:2-107 [119870] |
PDB Entry: 1v8h (more details), 1.2 Å
SCOPe Domain Sequences for d1v8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8ha1 b.1.18.19 (A:2-107) Sulfur oxidation protein SoxZ {Thermus thermophilus [TaxId: 274]} pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklel
Timeline for d1v8ha1: