Lineage for d1v8ga2 (1v8g A:66-329)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120359Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2120360Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2120361Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2120362Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)
  7. 2120397Species Thermus thermophilus [TaxId:274] [102269] (2 PDB entries)
  8. 2120402Domain d1v8ga2: 1v8g A:66-329 [100506]
    Other proteins in same PDB: d1v8ga1, d1v8gb1

Details for d1v8ga2

PDB Entry: 1v8g (more details), 2.1 Å

PDB Description: Crystal structure of anthranilate phosphoribosyltransferase (TrpD) from Thermus thermophilus HB8
PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1v8ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8ga2 c.27.1.1 (A:66-329) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]}
lrvhrrplldivgtggdgkglmnlstlaalvaaaggvavakhgnraassragsadlleal
gvdleappervgeaieelgfgflfarvfhpamrhvapvraelgvrtvfnllgpltnpaga
dayvlgvfspewlapmaealerlgarglvvhgegadelvlgenrvvevgkgayaltpeev
glkraplealkgggpeenaalarrllkgeekgpladavalaagagfyaagktpslkegva
larevlasgeayllleryvaflra

SCOPe Domain Coordinates for d1v8ga2:

Click to download the PDB-style file with coordinates for d1v8ga2.
(The format of our PDB-style files is described here.)

Timeline for d1v8ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v8ga1