Lineage for d1v7oa_ (1v7o A:)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/betaSuperfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) 
putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
Family d.67.1.2: Hypothetical protein PH0574 [103051] (1 protein) Protein Hypothetical protein PH0574 [103052] (1 species)
stand-alone protein related to the AlaRS domainSpecies Archaeon Pyrococcus horikoshii [TaxId:53953] [103053] (4 PDB entries) 
Domain d1v7oa_: 1v7o A: [100480]
Details for d1v7oa_
PDB Entry: 1v7o (more details), 2.62 Å
PDB Description: Alanyl-tRNA synthetase editing domain homologue protein from Pyrococcus horikoshii
PDB Compounds: (A:) Alanyl-tRNA synthetaseSCOP Domain Sequences for d1v7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v7oa_ d.67.1.2 (A:) Hypothetical protein PH0574 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
tkttgeigpikirkvrfrkskglleihfellelen
SCOP Domain Coordinates for d1v7oa_:
Click to download the PDB-style file with coordinates for d1v7oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v7oa_:
- d1v7oa_ first appeared in SCOP 1.67
- d1v7oa_ appears in SCOP 1.71
- d1v7oa_ appears in SCOP 1.75
- d1v7oa_ appears in the current release, SCOPe 2.08
View in 3D
