Lineage for d1v5la_ (1v5l A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1785885Protein Alpha-actinin-2 associated LIM protein [110178] (1 species)
  7. 1785886Species Mouse (Mus musculus) [TaxId:10090] [110179] (1 PDB entry)
    Uniprot O70209 4-93
  8. 1785887Domain d1v5la_: 1v5l A: [108378]
    Structural genomics target

Details for d1v5la_

PDB Entry: 1v5l (more details)

PDB Description: solution structure of pdz domain of mouse alpha-actinin-2 associated lim protein
PDB Compounds: (A:) PDZ and LIM domain 3; actinin alpha 2 associated LIM protein

SCOPe Domain Sequences for d1v5la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgnvvlpgpapwgfrlsggidfnqplvitritpgskaaaanlcpgdvilaidgfg
tesmthadaqdrikaasyqlclkidraetrlwspqvssgpssg

SCOPe Domain Coordinates for d1v5la_:

Click to download the PDB-style file with coordinates for d1v5la_.
(The format of our PDB-style files is described here.)

Timeline for d1v5la_: