Class a: All alpha proteins [46456] (286 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
Protein Microtubule-associated protein eb1, N-terminal microtubule binding domain [101194] (2 species) member of rp/eb family |
Species Mouse (Mus musculus) [TaxId:10090] [109829] (1 PDB entry) Uniprot Q61166 16-116 |
Domain d1v5ka_: 1v5k A: [108377] Structural genomics target |
PDB Entry: 1v5k (more details)
SCOPe Domain Sequences for d1v5ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ka_ a.40.1.1 (A:) Microtubule-associated protein eb1, N-terminal microtubule binding domain {Mouse (Mus musculus) [TaxId: 10090]} gssgssgqrrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakl eheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdsgpssg
Timeline for d1v5ka_: