Lineage for d1v4ta1 (1v4t A:15-218)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.3: Hexokinase [53083] (3 proteins) 
Protein Glucokinase [102479] (1 species)
Hexokinase DSpecies Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries) 
Domain d1v4ta1: 1v4t A:15-218 [100311]
complexed with na, so4
Details for d1v4ta1
PDB Entry: 1v4t (more details), 3.4 Å
PDB Description: crystal structure of human glucokinase
PDB Compounds: (A:) glucokinase isoform 2SCOPe Domain Sequences for d1v4ta1:
Sequence, based on SEQRES records: (download)
>d1v4ta1 c.55.1.3 (A:15-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
mveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdf
lsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfl
dkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgd
femdvvamvndtvatmiscyyedh
Sequence, based on observed residues (ATOM records): (download)
>d1v4ta1 c.55.1.3 (A:15-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
mveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdf
lsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfl
dkhqmkhkklplgftfsfpvrhnvvgllrdaikrrgdfemdvvamvndtvatmiscyyed
h
SCOPe Domain Coordinates for d1v4ta1:
Click to download the PDB-style file with coordinates for d1v4ta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v4ta1:
- d1v4ta1 first appeared in SCOP 1.67
- d1v4ta1 appears in SCOPe 2.06
- d1v4ta1 appears in the current release, SCOPe 2.08
View in 3D
