Lineage for d1v4nb_ (1v4n B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375180Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1375181Protein 5'-deoxy-5'-methylthioadenosine phosphorylase [53174] (3 species)
  7. 1375234Species Sulfolobus tokodaii [TaxId:111955] [117657] (1 PDB entry)
    Uniprot Q975C3
  8. 1375236Domain d1v4nb_: 1v4n B: [113531]
    structural genomics target

Details for d1v4nb_

PDB Entry: 1v4n (more details), 2.45 Å

PDB Description: Structure of 5'-deoxy-5'-methylthioadenosine phosphorylase homologue from Sulfolobus tokodaii
PDB Compounds: (B:) 271aa long hypothetical 5'-methylthioadenosine phosphorylase

SCOPe Domain Sequences for d1v4nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v4nb_ c.56.2.1 (B:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus tokodaii [TaxId: 111955]}
epkekasigiiggsglydpqiltnvkeikvytpygepsdniilgelegrkvaflprhgrg
hripphkinyraniwalkslgvkwviavsavgslrldykpgdfvvpnqfidmtkgrtytf
fdgptvahvsmadpfcehlrsiildsakdlgitthdkgtyiciegprfstraesivwkev
fkadiigmtlvpevnlaceaemcysvigmvtdydvfadipvtaeevtkvmaentakvkkl
lyevirrlpekpderkcsccqalktalvl

SCOPe Domain Coordinates for d1v4nb_:

Click to download the PDB-style file with coordinates for d1v4nb_.
(The format of our PDB-style files is described here.)

Timeline for d1v4nb_: