Lineage for d1v3wa_ (1v3w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814071Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 2814072Protein Ferripyochelin binding protein [101965] (1 species)
  7. 2814073Species Pyrococcus horikoshii [TaxId:53953] [101966] (3 PDB entries)
  8. 2814074Domain d1v3wa_: 1v3w A: [100291]
    complexed with ca, cl, edo, gol, zn

Details for d1v3wa_

PDB Entry: 1v3w (more details), 1.5 Å

PDB Description: Structure of Ferripyochelin binding protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) ferripyochelin binding protein

SCOPe Domain Sequences for d1v3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Pyrococcus horikoshii [TaxId: 53953]}
maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri

SCOPe Domain Coordinates for d1v3wa_:

Click to download the PDB-style file with coordinates for d1v3wa_.
(The format of our PDB-style files is described here.)

Timeline for d1v3wa_: