Lineage for d1v3ta2 (1v3t A:113-294)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819420Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 819709Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110405] (1 species)
  7. 819710Species Guinea pig (Cavia porcellus) [TaxId:10141] [110406] (4 PDB entries)
    Uniprot Q9EQZ5
  8. 819717Domain d1v3ta2: 1v3t A:113-294 [108338]
    Other proteins in same PDB: d1v3ta1, d1v3tb1

Details for d1v3ta2

PDB Entry: 1v3t (more details), 2.3 Å

PDB Description: Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
PDB Compounds: (A:) leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase

SCOP Domain Sequences for d1v3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3ta2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
lplslalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvga
agsdekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkd
fgkiaicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvl
eg

SCOP Domain Coordinates for d1v3ta2:

Click to download the PDB-style file with coordinates for d1v3ta2.
(The format of our PDB-style files is described here.)

Timeline for d1v3ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v3ta1