![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
![]() | Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
![]() | Protein Cobalt-containing nitrile hydratase [82799] (2 species) |
![]() | Species Bacillus smithii [TaxId:1479] [118143] (1 PDB entry) Uniprot Q84FS5 # 93% sequence identity; Bacillus sp. RAPc8 TaxID: 218609 |
![]() | Domain d1v29a_: 1v29 A: [113493] Other proteins in same PDB: d1v29b_ complexed with co |
PDB Entry: 1v29 (more details), 2.6 Å
SCOPe Domain Sequences for d1v29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v29a_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]} dprfphhhprpqsfwearakaleslliekrllssdaiervikhyehelgpmngakvvaka wtdpefkqrlledpetvlrelgyfglqgehirvventdtvhnvvvctlcscypwpllglp pswykepayrsrvvkeprkvlqefgldlpdsveirvwdsssevrfmvlpqrpegtegmte eelaqivtrdsmigvakvqppkv
Timeline for d1v29a_: