Lineage for d1v29a_ (1v29 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheetsSuperfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) 
duplication: contains two structural repeatsFamily d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
automatically mapped to Pfam PF02979
Protein Cobalt-containing nitrile hydratase [82799] (2 species) 
Species Bacillus smithii [TaxId:1479] [118143] (1 PDB entry)
Uniprot Q84FS5 # 93% sequence identity; Bacillus sp. RAPc8 TaxID: 218609
Domain d1v29a_: 1v29 A: [113493]
Other proteins in same PDB: d1v29b_
complexed with co
Details for d1v29a_
PDB Entry: 1v29 (more details), 2.6 Å
PDB Description: crystal structure of nitrile hydratase from a thermophile bacillus smithii
PDB Compounds: (A:) nitrile hydratase a chainSCOPe Domain Sequences for d1v29a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v29a_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]}
dprfphhhprpqsfwearakaleslliekrllssdaiervikhyehelgpmngakvvaka
wtdpefkqrlledpetvlrelgyfglqgehirvventdtvhnvvvctlcscypwpllglp
pswykepayrsrvvkeprkvlqefgldlpdsveirvwdsssevrfmvlpqrpegtegmte
eelaqivtrdsmigvakvqppkv
SCOPe Domain Coordinates for d1v29a_:
Click to download the PDB-style file with coordinates for d1v29a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v29a_:
- d1v29a_ first appeared in SCOP 1.71
- d1v29a_ appears in SCOPe 2.07
View in 3D
