Lineage for d1v27a_ (1v27 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792148Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 792220Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 792240Protein Regulating synaptic membrane exocytosis protein, rim2 [101564] (1 species)
  7. 792241Species Human (Homo sapiens) [TaxId:9606] [101565] (2 PDB entries)
  8. 792243Domain d1v27a_: 1v27 A: [100262]
    first C2 domain

Details for d1v27a_

PDB Entry: 1v27 (more details)

PDB Description: Solution structure of the first C2 domain of RIM2
PDB Compounds: (A:) Regulating synaptic membrane exocytosis protein 2

SCOP Domain Sequences for d1v27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v27a_ b.7.1.2 (A:) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}
gssgssggqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkr
rtktvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieleta
llddephwyklqthdsgpssg

SCOP Domain Coordinates for d1v27a_:

Click to download the PDB-style file with coordinates for d1v27a_.
(The format of our PDB-style files is described here.)

Timeline for d1v27a_: