Lineage for d1v16b2 (1v16 B:205-342)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the restSuperfamily c.48.1: TK C-terminal domain-like [52922] (4 families) 
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
automatically mapped to Pfam PF02780Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries)
Uniprot P21953 52-392
Domain d1v16b2: 1v16 B:205-342 [108242]
Other proteins in same PDB: d1v16a_, d1v16b1
complexed with ben, cl, gol, k, mn, tdp
Details for d1v16b2
PDB Entry: 1v16 (more details), 1.9 Å
PDB Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunitSCOPe Domain Sequences for d1v16b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v16b2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy
SCOPe Domain Coordinates for d1v16b2:
Click to download the PDB-style file with coordinates for d1v16b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v16b2:
- d1v16b2 first appeared in SCOP 1.69
- d1v16b2 appears in SCOPe 2.02
- d1v16b2 appears in SCOPe 2.04
- d1v16b2 appears in the current release, SCOPe 2.08
View in 3D
