Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins) automatically mapped to Pfam PF02780 |
Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52928] (23 PDB entries) Uniprot P21953 52-392 |
Domain d1v16b2: 1v16 B:205-342 [108242] Other proteins in same PDB: d1v16a_, d1v16b1 complexed with ben, cl, gol, k, mn, tdp |
PDB Entry: 1v16 (more details), 1.9 Å
SCOPe Domain Sequences for d1v16b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v16b2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf yipdkwkcydalrkminy
Timeline for d1v16b2: