Lineage for d1v16b1 (1v16 B:2-204)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) 
there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
parent family to TK and PFOR
heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
automatically mapped to Pfam PF02779Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) Species Human (Homo sapiens) [TaxId:9606] [88743] (23 PDB entries)
Uniprot P21953 52-392
Domain d1v16b1: 1v16 B:2-204 [108241]
Other proteins in same PDB: d1v16a_, d1v16b2
complexed with ben, cl, gol, k, mn, tdp
Details for d1v16b1
PDB Entry: 1v16 (more details), 1.9 Å
PDB Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
PDB Compounds: (B:) 2-oxoisovalerate dehydrogenase beta subunitSCOPe Domain Sequences for d1v16b1:
Sequence, based on SEQRES records: (download)
>d1v16b1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie
Sequence, based on observed residues (ATOM records): (download)
>d1v16b1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens) [TaxId: 9606]}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie
SCOPe Domain Coordinates for d1v16b1:
Click to download the PDB-style file with coordinates for d1v16b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v16b1:
- d1v16b1 first appeared in SCOP 1.69
- d1v16b1 appears in SCOPe 2.05
- d1v16b1 appears in SCOPe 2.07
- d1v16b1 appears in the current release, SCOPe 2.08
View in 3D
