| Class b: All beta proteins [48724] (177 folds) |
| Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
| Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (3 proteins) Pfam PF00251; Glycosyl hydrolase family 32 |
| Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [101886] (2 PDB entries) |
| Domain d1uypa2: 1uyp A:1-294 [100177] Other proteins in same PDB: d1uypa1, d1uypb1, d1uypc1, d1uypd1, d1uype1, d1uypf1 complexed with cit, gol, na, so4 |
PDB Entry: 1uyp (more details), 1.9 Å
SCOPe Domain Sequences for d1uypa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uypa2 b.67.2.3 (A:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp
Timeline for d1uypa2: