Lineage for d1uxaa_ (1uxa A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048518Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2048519Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2048532Species Human adenovirus 37 [TaxId:52275] [110136] (11 PDB entries)
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 2048533Domain d1uxaa_: 1uxa A: [108091]
    complexed with act, zn

Details for d1uxaa_

PDB Entry: 1uxa (more details), 1.5 Å

PDB Description: adenovirus ad37 fibre head in complex with sialyl-lactose
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d1uxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxaa_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus 37 [TaxId: 52275]}
ydtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpk
iksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnsk
kyardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfs
yiaqe

SCOPe Domain Coordinates for d1uxaa_:

Click to download the PDB-style file with coordinates for d1uxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1uxaa_: