Lineage for d1ux8a_ (1ux8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685880Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2685881Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2685882Species Bacillus subtilis [TaxId:1423] [116748] (1 PDB entry)
    Uniprot O31607 6-124 # YjbI
  8. 2685883Domain d1ux8a_: 1ux8 A: [113449]
    complexed with cl, cyn, hem

Details for d1ux8a_

PDB Entry: 1ux8 (more details), 2.15 Å

PDB Description: x-ray structure of truncated oxygen-avid haemoglobin from bacillus subtilis
PDB Compounds: (A:) yjbi protein

SCOPe Domain Sequences for d1ux8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]}
napyeaigeellsqlvdtfyervashpllkpifpsdltetarkqkqfltqylggpplyte
ehghpmlrarhlpfpitneradawlscmkdamdhvglegeireflfgrleltarhmvnq

SCOPe Domain Coordinates for d1ux8a_:

Click to download the PDB-style file with coordinates for d1ux8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ux8a_: