Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
Species Bacillus subtilis [TaxId:1423] [116748] (1 PDB entry) Uniprot O31607 6-124 # YjbI |
Domain d1ux8a_: 1ux8 A: [113449] complexed with cl, cyn, hem |
PDB Entry: 1ux8 (more details), 2.15 Å
SCOPe Domain Sequences for d1ux8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ux8a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Bacillus subtilis [TaxId: 1423]} napyeaigeellsqlvdtfyervashpllkpifpsdltetarkqkqfltqylggpplyte ehghpmlrarhlpfpitneradawlscmkdamdhvglegeireflfgrleltarhmvnq
Timeline for d1ux8a_: