Lineage for d1uwva2 (1uwv A:75-432)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865438Family c.66.1.40: (Uracil-5-)-methyltransferase [102581] (1 protein)
    Pfam PF05958
  6. 1865439Protein rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain [102582] (1 species)
    includes an iron-sulfur cluster-binding, alpha+beta sudbomain
  7. 1865440Species Escherichia coli [TaxId:562] [102583] (2 PDB entries)
  8. 1865441Domain d1uwva2: 1uwv A:75-432 [100129]
    Other proteins in same PDB: d1uwva1
    complexed with cl, ni, po4, sf4

Details for d1uwva2

PDB Entry: 1uwv (more details), 1.95 Å

PDB Description: crystal structure of ruma, the iron-sulfur cluster containing e. coli 23s ribosomal rna 5-methyluridine methyltransferase
PDB Compounds: (A:) 23s rRNA (uracil-5-)-methyltransferase ruma

SCOPe Domain Sequences for d1uwva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]}
eretprcphfgvcggcqqqhasvdlqqrsksaalarlmkhdvseviadvpwgyrrrarls
lnylpktqqlqmgfrkagssdivdvkqcpilapqleallpkvraclgslqamrhlghvel
vqatsgtlmilrhtaplssadreklerfshsegldlylapdseiletvsgempwydsngl
rltfsprdfiqvnagvnqkmvaralewldvqpedrvldlfcgmgnftlplatqaasvvgv
egvpalvekgqqnarlnglqnvtfyhenleedvtkqpwakngfdkvlldparagaagvmq
qiiklepirivyvscnpatlardseallkagytiarlamldmfphtghlesmvlfsrv

SCOPe Domain Coordinates for d1uwva2:

Click to download the PDB-style file with coordinates for d1uwva2.
(The format of our PDB-style files is described here.)

Timeline for d1uwva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uwva1