Lineage for d1uwva1 (1uwv A:15-74)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) 
Family b.40.4.12: TRAM domain [101768] (3 proteins)
Pfam PF01938Protein rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain [101769] (1 species) Species Escherichia coli [TaxId:562] [101770] (2 PDB entries) 
Domain d1uwva1: 1uwv A:15-74 [100128]
Other proteins in same PDB: d1uwva2
complexed with cl, ni, po4, sf4
Details for d1uwva1
PDB Entry: 1uwv (more details), 1.95 Å
PDB Description: crystal structure of ruma, the iron-sulfur cluster containing e. coli 23s ribosomal rna 5-methyluridine methyltransferase
PDB Compounds: (A:) 23s rRNA (uracil-5-)-methyltransferase rumaSCOPe Domain Sequences for d1uwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwva1 b.40.4.12 (A:15-74) rRNA (Uracil-5-)-methyltransferase RumA, N-terminal domain {Escherichia coli [TaxId: 562]}
qiitvsvndldsfgqgvarhngktlfipgllpqenaevtvtedkkqyarakvvrrlsdsp
SCOPe Domain Coordinates for d1uwva1:
Click to download the PDB-style file with coordinates for d1uwva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uwva1:
- d1uwva1 first appeared in SCOP 1.67
- d1uwva1 appears in SCOPe 2.02
- d1uwva1 appears in SCOPe 2.04
- d1uwva1 appears in the current release, SCOPe 2.08
View in 3D
