Lineage for d1uwha_ (1uwh A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein B-Raf kinase [103290] (1 species)
OPK group; RAF subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinasesSpecies Human (Homo sapiens) [TaxId:9606] [103291] (2 PDB entries) 
Domain d1uwha_: 1uwh A: [100123]
complexed with bax, cl
Details for d1uwha_
PDB Entry: 1uwh (more details), 2.95 Å
PDB Description: the complex of wild type b-raf and bay439006.
PDB Compounds: (A:) B-Raf proto-oncogene serine/threonine-protein kinaseSCOPe Domain Sequences for d1uwha_:
Sequence, based on SEQRES records: (download)
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarslpk
Sequence, based on observed residues (ATOM records): (download)
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystapqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvlsgsilwmapevirmqdknpysfqsdv
yafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkk
krderplfpqilasiellarslpk
SCOPe Domain Coordinates for d1uwha_:
Click to download the PDB-style file with coordinates for d1uwha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uwha_:
- d1uwha_ first appeared in SCOP 1.67
- d1uwha_ appears in SCOPe 2.03
- d1uwha_ appears in SCOPe 2.05
- d1uwha_ appears in the current release, SCOPe 2.08
View in 3D
