Lineage for d1uwfa_ (1uwf A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300701Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1300702Species Escherichia coli [TaxId:562] [49407] (21 PDB entries)
  8. 1300715Domain d1uwfa_: 1uwf A: [119758]
    automated match to d1uwfa1
    complexed with deg, gol

Details for d1uwfa_

PDB Entry: 1uwf (more details), 1.69 Å

PDB Description: 1.7 a resolution structure of the receptor binding domain of the fimh adhesin from uropathogenic e. coli
PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d1uwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwfa_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d1uwfa_:

Click to download the PDB-style file with coordinates for d1uwfa_.
(The format of our PDB-style files is described here.)

Timeline for d1uwfa_: