Lineage for d1uwda_ (1uwd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947439Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 2947450Family d.52.8.2: PaaD-like [117922] (3 proteins)
    Pfam PF01883; DUF59
  6. 2947451Protein Hypothetical protein TM0487 [117923] (1 species)
  7. 2947452Species Thermotoga maritima [TaxId:2336] [117924] (2 PDB entries)
    Uniprot Q9WYV7
  8. 2947453Domain d1uwda_: 1uwd A: [113447]
    Structural genomics target

Details for d1uwda_

PDB Entry: 1uwd (more details)

PDB Description: nmr structure of a protein with unknown function from thermotoga maritima (tm0487), which belongs to the duf59 family.
PDB Compounds: (A:) hypothetical protein tm0487

SCOPe Domain Sequences for d1uwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]}
mskkvtkedvlnalknvidfelgldvvslglvydiqiddqnnvkvlmtmttpmcplagmi
lsdaeeaikkiegvnnveveltfdppwtpermspelrekfgv

SCOPe Domain Coordinates for d1uwda_:

Click to download the PDB-style file with coordinates for d1uwda_.
(The format of our PDB-style files is described here.)

Timeline for d1uwda_: