Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Oxalate decarboxylase OxdC (YvrK) [75033] (1 species) duplication: consists of two germin-like metal-ion binding domains |
Species Bacillus subtilis [TaxId:1423] [75034] (4 PDB entries) |
Domain d1uw8a_: 1uw8 A: [100100] complexed with mn, trs multiple common domains: applies to families that are inconsistently divided into domains has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1uw8 (more details), 2 Å
SCOPe Domain Sequences for d1uw8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw8a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd vgegdlwyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkeviaanfg vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk dftdvlskekhpvvkkk
Timeline for d1uw8a_: