Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.4: Smg-4/UPF3 [102987] (2 proteins) Pfam PF03467 |
Protein RNA processing protein UPF3x, RRM domain [102988] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102989] (1 PDB entry) |
Domain d1uw4a_: 1uw4 A: [100071] Other proteins in same PDB: d1uw4b_, d1uw4d_ complexed with bme |
PDB Entry: 1uw4 (more details), 1.95 Å
SCOPe Domain Sequences for d1uw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil frdrfdgyvfldnkgqeypaivefapfqkaa
Timeline for d1uw4a_: