Lineage for d1utxa_ (1utx A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
core: 4 helices; folded leaf, closedSuperfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) 
Family a.35.1.3: SinR domain-like [47432] (9 proteins) Protein Putative transcription regulator CylR2 [109811] (1 species) Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
Uniprot Q8VL32
Domain d1utxa_: 1utx A: [108034]
complexed with iod, na
Details for d1utxa_
PDB Entry: 1utx (more details), 1.9 Å
PDB Description: regulation of cytolysin expression by enterococcus faecalis: role of cylr2
PDB Compounds: (A:) cylr2SCOPe Domain Sequences for d1utxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe
SCOPe Domain Coordinates for d1utxa_:
Click to download the PDB-style file with coordinates for d1utxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1utxa_:
- d1utxa_ first appeared in SCOP 1.69
- d1utxa_ appears in SCOPe 2.06
- d1utxa_ appears in the current release, SCOPe 2.08
View in 3D
