Lineage for d1utxa_ (1utx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1995785Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1995832Protein Putative transcription regulator CylR2 [109811] (1 species)
  7. 1995833Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
    Uniprot Q8VL32
  8. 1995836Domain d1utxa_: 1utx A: [108034]
    complexed with iod, na

Details for d1utxa_

PDB Entry: 1utx (more details), 1.9 Å

PDB Description: regulation of cytolysin expression by enterococcus faecalis: role of cylr2
PDB Compounds: (A:) cylr2

SCOPe Domain Sequences for d1utxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

SCOPe Domain Coordinates for d1utxa_:

Click to download the PDB-style file with coordinates for d1utxa_.
(The format of our PDB-style files is described here.)

Timeline for d1utxa_: