![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
![]() | Protein Mammalian purple acid phosphatase [56304] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [56306] (2 PDB entries) |
![]() | Domain d1utea_: 1ute A: [42078] complexed with feo, ipa, po4 |
PDB Entry: 1ute (more details), 1.55 Å
SCOPe Domain Sequences for d1utea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} ptpilrfvavgdwggvpnapfhtaremanakaiattvktlgadfilslgdnfyftgvhda kdkrfqetfedvfsdpslrnvpwhvlagnhdhlgnvsaqiayskiskrwnfpspyyrlrf kiprsnvsvaifmldtvtlcgnsddfvsqqperprnlalartqlawikkqlaaakedyvl vaghypvwsiaehgpthclvkqllplltthkvtaylcghdhnlqylqdenglgfvlsgag nfmdpskkhlrkvpngylrfhfgaenslggfayveitpkemsvtyieasgkslfktklpr ra
Timeline for d1utea_: