Lineage for d1utcb2 (1utc B:3-330)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
consists of seven 4-stranded beta-sheet motifs; meander
Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) 
Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins) 
Protein Clathrin heavy-chain terminal domain [50991] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [50992] (5 PDB entries) 
Domain d1utcb2: 1utc B:3-330 [99917]
Other proteins in same PDB: d1utca1, d1utcb1
complexed with peptide tlpwdlwtt from amphiphysin
Details for d1utcb2
PDB Entry: 1utc (more details), 2.3 Å
PDB Description: clathrin terminal domain complexed with tlpwdlwtt
PDB Compounds: (B:) clathrin heavy chainSCOPe Domain Sequences for d1utcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utcb2 b.69.6.1 (B:3-330) Clathrin heavy-chain terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsnpi
rrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntvalv
tdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvgamq
lysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgnqp
fpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisget
ifvtapheatagiigvnrkgqvlsvcve
SCOPe Domain Coordinates for d1utcb2:
Click to download the PDB-style file with coordinates for d1utcb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1utcb2:
- d1utcb2 first appeared in SCOP 1.67
- d1utcb2 appears in SCOPe 2.05
- d1utcb2 appears in SCOPe 2.07
- d1utcb2 appears in the current release, SCOPe 2.08
View in 3D
