| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
| Protein LysR-type regulatory protein DntR [110748] (1 species) |
| Species Burkholderia sp. [TaxId:36773] [110749] (2 PDB entries) Uniprot Q7WT50 75-301 |
| Domain d1utba_: 1utb A: [108030] complexed with act, gol |
PDB Entry: 1utb (more details), 2.59 Å
SCOPe Domain Sequences for d1utba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utba_ c.94.1.1 (A:) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]}
sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghge
vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
pdiainlfwhakynrdpgnmwlrqlfvelfseah
Timeline for d1utba_: