Lineage for d1ut7a_ (1ut7 A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.143: NAC domain [101940] (1 superfamily)
core: twisted 7-stranded beta-sheet (half-barrel)Superfamily b.143.1: NAC domain [101941] (1 family) 
Family b.143.1.1: NAC domain [101942] (2 proteins)
Pfam PF02365, NAM; transcription factor domainProtein No apical meristem (NAM, ANAC) [101943] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101944] (2 PDB entries) 
Domain d1ut7a_: 1ut7 A: [99906]
complexed with au
Details for d1ut7a_
PDB Entry: 1ut7 (more details), 1.9 Å
PDB Description: structure of the conserved domain of anac, a member of the nac family of transcription factors
PDB Compounds: (A:) no apical meristem proteinSCOPe Domain Sequences for d1ut7a_:
Sequence, based on SEQRES records: (download)
>d1ut7a_ b.143.1.1 (A:) No apical meristem (NAM, ANAC) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmgiqetdpltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpw
vlpnkalfgekewyffsprdrkypngsrpnrvagsgywkatgtdkiistegqrvgikkal
vfyigkapkgtktnwimheyrliepsrrngstklddwvlcriykkq
Sequence, based on observed residues (ATOM records): (download)
>d1ut7a_ b.143.1.1 (A:) No apical meristem (NAM, ANAC) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmgiqltqlslppgfrfyptdeelmvqylcrkaagydfslqliaeidlykfdpwvlpn
kalfgekewyffsprdrpnrvagsgywkatgtdkiistegqrvgikkalvfyigkapkgt
ktnwimheyrliepsddwvlcriykkq
SCOPe Domain Coordinates for d1ut7a_:
Click to download the PDB-style file with coordinates for d1ut7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ut7a_:
- d1ut7a_ first appeared in SCOP 1.67
- d1ut7a_ appears in SCOPe 2.06
- d1ut7a_ appears in the current release, SCOPe 2.08, called d1ut7a1
View in 3D
