| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.227: OsmC-like [82783] (1 superfamily) swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix |
Superfamily d.227.1: OsmC-like [82784] (3 families) ![]() |
| Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins) |
| Protein Organic hydroperoxide resistance protein Ohr [82786] (3 species) |
| Species Deinococcus radiodurans [TaxId:1299] [103270] (1 PDB entry) |
| Domain d1uspa_: 1usp A: [99879] complexed with gol |
PDB Entry: 1usp (more details), 1.9 Å
SCOPe Domain Sequences for d1uspa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uspa_ d.227.1.1 (A:) Organic hydroperoxide resistance protein Ohr {Deinococcus radiodurans [TaxId: 1299]}
nvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqgal
gvvsrrqkidvpadstitarvglqkaglafaldveleghfpglsreqaeglmhaahevcp
ysaatrnnvdvrlkvre
Timeline for d1uspa_: