Lineage for d1usca_ (1usc A:)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.45: Split barrel-like [50474] (3 superfamilies)
barrel; n=6, S=10; greek-keySuperfamily b.45.1: FMN-binding split barrel [50475] (5 families) 
related to the ferredoxin reductase-like FAD-binding domain
Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
different dimerization mode than in the PNP-oxidase like familyProtein Putative styrene monooxygenase small component [101796] (1 species) Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries) 
Domain d1usca_: 1usc A: [99860]
complexed with act, fmn
Details for d1usca_
PDB Entry: 1usc (more details), 1.24 Å
PDB Description: putative styrene monooxygenase small component
PDB Compounds: (A:) putative styrene monooxygenase small componentSCOPe Domain Sequences for d1usca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usca_ b.45.1.2 (A:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
SCOPe Domain Coordinates for d1usca_:
Click to download the PDB-style file with coordinates for d1usca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1usca_:
- d1usca_ first appeared in SCOP 1.67
- d1usca_ appears in SCOPe 2.06
- d1usca_ appears in the current release, SCOPe 2.08
View in 3D
