Class a: All alpha proteins [46456] (285 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.1: BAR domain [103658] (4 proteins) sensor of membrane curvature |
Protein Amphiphysin [103659] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103660] (1 PDB entry) |
Domain d1urua_: 1uru A: [99835] |
PDB Entry: 1uru (more details), 2.6 Å
SCOPe Domain Sequences for d1urua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qnlgkvdrtadeifddhlnnfnrqqasanrlqkefnnyircvraaqaasktlmdsvceiy epqwsgydalqaqtgaseslwadfahklgdqvliplntytgqfpemkkkvekrnrklidy dgqrhsfqnlqanankrkddvkltkgreqleearrtyeilntelhdelpalydsrilflv tnlqtlfateqvfhnetakiyseleaivdklatesqr
Timeline for d1urua_: