Lineage for d1urpa_ (1urp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2912936Protein D-ribose-binding protein [53824] (1 species)
  7. 2912937Species Escherichia coli, strain k-12 [TaxId:562] [53825] (6 PDB entries)
  8. 2912943Domain d1urpa_: 1urp A: [35643]

Details for d1urpa_

PDB Entry: 1urp (more details), 2.3 Å

PDB Description: d-ribose-binding protein from escherichia coli
PDB Compounds: (A:) d-ribose-binding protein

SCOPe Domain Sequences for d1urpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urpa_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]}
kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
gakgvetadkvlkgekvqakypvdlklvvkq

SCOPe Domain Coordinates for d1urpa_:

Click to download the PDB-style file with coordinates for d1urpa_.
(The format of our PDB-style files is described here.)

Timeline for d1urpa_: