Lineage for d1urma_ (1urm A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369372Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1369506Protein Peroxiredoxin 5 [64066] (1 species)
  7. 1369507Species Human (Homo sapiens) [TaxId:9606] [64067] (4 PDB entries)
    Uniprot P30044
  8. 1369509Domain d1urma_: 1urm A: [113413]
    complexed with bez, cl; mutant

Details for d1urma_

PDB Entry: 1urm (more details), 1.7 Å

PDB Description: human peroxiredoxin 5, c47s mutant
PDB Compounds: (A:) peroxiredoxin 5

SCOPe Domain Sequences for d1urma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urma_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]}
sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgsskthlpgfveqa
ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi
fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

SCOPe Domain Coordinates for d1urma_:

Click to download the PDB-style file with coordinates for d1urma_.
(The format of our PDB-style files is described here.)

Timeline for d1urma_: