![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
![]() | Protein Not-4 N-terminal RING finger domain [64579] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64580] (2 PDB entries) |
![]() | Domain d1ur6b_: 1ur6 B: [99812] Other proteins in same PDB: d1ur6a_ complexed with zn |
PDB Entry: 1ur6 (more details)
SCOPe Domain Sequences for d1ur6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} vecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpyped
Timeline for d1ur6b_: