| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein Ste50p, N-terminal domain [101244] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries) |
| Domain d1uqva_: 1uqv A: [99798] |
PDB Entry: 1uqv (more details)
SCOPe Domain Sequences for d1uqva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uqva_ a.60.1.2 (A:) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmnnedfsqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcd
gdlnkaikfkilinkmrdsklewkd
Timeline for d1uqva_: