Lineage for d1uqva_ (1uqv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272203Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1272267Protein Ste50p, N-terminal domain [101244] (1 species)
  7. 1272268Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries)
  8. 1272270Domain d1uqva_: 1uqv A: [99798]

Details for d1uqva_

PDB Entry: 1uqv (more details)

PDB Description: sam domain from ste50p
PDB Compounds: (A:) ste50 protein

SCOPe Domain Sequences for d1uqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqva_ a.60.1.2 (A:) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmnnedfsqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcd
gdlnkaikfkilinkmrdsklewkd

SCOPe Domain Coordinates for d1uqva_:

Click to download the PDB-style file with coordinates for d1uqva_.
(The format of our PDB-style files is described here.)

Timeline for d1uqva_: