Lineage for d1upha_ (1uph A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002315Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2002316Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2002317Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2002318Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 2002319Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (10 PDB entries)
  8. 2002329Domain d1upha_: 1uph A: [99756]
    myristoylated protein

Details for d1upha_

PDB Entry: 1uph (more details)

PDB Description: hiv-1 myristoylated matrix
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d1upha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1upha_ a.61.1.1 (A:) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
xgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi
lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa
dtgnnsqvsqny

SCOPe Domain Coordinates for d1upha_:

Click to download the PDB-style file with coordinates for d1upha_.
(The format of our PDB-style files is described here.)

Timeline for d1upha_: