Lineage for d1uoua3 (1uou A:374-480)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945238Family d.41.3.1: Pyrimidine nucleoside phosphorylase C-terminal domain [54681] (2 proteins)
  6. 2945243Protein Thymidine phosphorylase [54682] (2 species)
  7. 2945253Species Human (Homo sapiens) [TaxId:9606] [102921] (1 PDB entry)
  8. 2945254Domain d1uoua3: 1uou A:374-480 [99708]
    Other proteins in same PDB: d1uoua1, d1uoua2
    complexed with cmu

Details for d1uoua3

PDB Entry: 1uou (more details), 2.11 Å

PDB Description: crystal structure of human thymidine phosphorylase in complex with a small molecule inhibitor
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1uoua3:

Sequence, based on SEQRES records: (download)

>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
rareqeellapadgtvelvralplalvlhelgagrageplrlgvgaellvdvgqrlrrgt
pwlrvhrdgpalsgpqsralqealvlsdrapfaaplpfaelvlpp

Sequence, based on observed residues (ATOM records): (download)

>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]}
rareqeellapadgtvelvralplalvlhelgalrlgvgaellvdvgqrlrrgtpwlrvh
rdgpalsgpqsralqealvlsdrapfaaplpfaelvlpp

SCOPe Domain Coordinates for d1uoua3:

Click to download the PDB-style file with coordinates for d1uoua3.
(The format of our PDB-style files is described here.)

Timeline for d1uoua3: